PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00004145-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NAC
Protein Properties Length: 338aa    MW: 38626.1 Da    PI: 6.0867
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00004145-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.16.9e-5381361128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eelv +yL++++++ k++l +vi ++d+yk+ePwd+++k+k    e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+
  WALNUT_00004145-RA   8 VPPGFRFHPTEEELVGYYLRRRMNSLKIDL-DVIVDIDLYKIEPWDIQAKCKLgydERNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGR 97 
                         69****************************.99**************953333333566******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk+vls k+  +g++ktLvfykgrap+g+ktdW+mheyrl
  WALNUT_00004145-RA  98 DKAVLS-KNLIIGMRKTLVFYKGRAPSGRKTDWIMHEYRL 136
                         ******.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-605157IPR003441NAC domain
PROSITE profilePS5100557.828157IPR003441NAC domain
PfamPF023657.7E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDQMESCVPP GFRFHPTEEE LVGYYLRRRM NSLKIDLDVI VDIDLYKIEP WDIQAKCKLG  60
YDERNEWYFF SHKDKKYPTG TRTNRATAAG FWKATGRDKA VLSKNLIIGM RKTLVFYKGR  120
APSGRKTDWI MHEYRLQTSE NGPPQEEGWV VCRAFKKPSP NHRQGFEAWA HGYYHRDNSQ  180
VRLPAFSDLV GSTTNEEVNP NQAATFDDHQ PIMINSVLQD QLVCSHGTNL LTNQLTELPQ  240
LDSPSTLSTS LATKEGNLQH KYGIALNEDF DDERSSITSH YIDWRNLDDL LSSQFSSTTA  300
TTNSFPHPNL PLIAQENEVL EAQNYNAGGH FLGCFPDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-48816320174NAC domain-containing protein 19
3swp_C2e-48816320174NAC domain-containing protein 19
3swp_B2e-48816320174NAC domain-containing protein 19
3swp_A2e-48816320174NAC domain-containing protein 19
3swm_D2e-48816320174NAC domain-containing protein 19
3swm_C2e-48816320174NAC domain-containing protein 19
3swm_B2e-48816320174NAC domain-containing protein 19
3swm_A2e-48816320174NAC domain-containing protein 19
4dul_B2e-48816317171NAC domain-containing protein 19
4dul_A2e-48816317171NAC domain-containing protein 19
1ut7_B2e-48816317171NO APICAL MERISTEM PROTEIN
1ut7_A2e-48816317171NO APICAL MERISTEM PROTEIN
1ut4_B2e-48816317171NO APICAL MERISTEM PROTEIN
1ut4_A2e-48816317171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001778.11e-159PREDICTED: NAC domain-containing protein 7-like isoform X2
RefseqXP_011001780.11e-159PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9C8W91e-117NAC30_ARATH; NAC domain-containing protein 30
TrEMBLE5KUI21e-160E5KUI2_POPTR; Transcription factor
STRINGPOPTR_0013s11740.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.15e-96vascular related NAC-domain protein 7